PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013590812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 247aa    MW: 27943.9 Da    PI: 8.9216
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013590812.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
   XP_013590812.1 10 KGAWTAEEDNLLRQCIDKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding47.15.6e-1563108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+   +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
   XP_013590812.1  63 RGKLNSDEVDLLIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      6777889***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-21559IPR009057Homeodomain-like
PROSITE profilePS5129426.899561IPR017930Myb domain
SuperFamilySSF466892.91E-287104IPR009057Homeodomain-like
SMARTSM007172.9E-15959IPR001005SANT/Myb domain
PfamPF002497.2E-161057IPR001005SANT/Myb domain
CDDcd001677.13E-111257No hitNo description
Gene3DG3DSA:1.10.10.607.7E-2260111IPR009057Homeodomain-like
SMARTSM007173.7E-1462110IPR001005SANT/Myb domain
PROSITE profilePS5129419.88662112IPR017930Myb domain
PfamPF002492.4E-1363108IPR001005SANT/Myb domain
CDDcd001671.52E-1069108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEGMSKGLKK GAWTAEEDNL LRQCIDKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS  60
IKRGKLNSDE VDLLIRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHEPGCKTQM  120
KKRNIPCSYT TPAQKIDVFK PRPRSFTVNN GCSHINGMAE ADIVPLCLGL NDTNNVSENI  180
ITCNKDDDKF ELVSNLMDGQ NRWWESLLDE SQDPAALFPE ATATKKGATS AFDVEQLWSL  240
LDGETGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2181115107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.141601e-173leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4034500.0KM403450.1 Brassica rapa cultivar Zi He anthocyanin R2R3-MYB transcription factor (MYB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590812.10.0PREDICTED: transcription factor MYB114-like
SwissprotQ9ZTC31e-125MYB90_ARATH; Transcription factor MYB90
TrEMBLA0A0D3CYD90.0A0A0D3CYD9_BRAOL; Uncharacterized protein
TrEMBLE5D8F40.0E5D8F4_BRAOB; MYB2
STRINGBra004162.1-P1e-176(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66390.11e-126myb domain protein 90